ACTR3 anticorps

N° du produit ABIN631909

Cet anticorps Lapin Polyclonal détecte spécifiquement ACTR3 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour ACTR3 anticorps (ABIN631909)

Antigène: ACTR3 (ARP3 Actin-Related Protein 3 (ACTR3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACTR3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ACTR3 anticorps

Purification: Affinity purified

Immunogène: ACTR3 antibody was raised using a synthetic peptide corresponding to a region with amino acids IAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACTR3 Blocking Peptide, (ABIN939277), is also available for use as a blocking control in assays to test for specificity of this ACTR3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACTR3

Antigène: ACTR3 (ARP3 Actin-Related Protein 3 (ACTR3))

Autre désignation: ACTR3

Sujet: The specific function of this gene has not yet been determined, however, the protein it encodes is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: Signalisation RTK, Regulation of Actin Filament Polymerization